PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_3237AA694.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 249aa    MW: 26195.9 Da    PI: 6.7991
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_3237AA694.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.84.9e-5633128297
                  NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 
                            +eqdrflPianvsrimk+ lPanakisk+aketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe yv+plk+yl++
  Traes_2BL_3237AA694.1  33 KEQDRFLPIANVSRIMKRSLPANAKISKEAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEVYVAPLKAYLNR 120
                            89************************************************************************************** PP

                  NF-YB  90 yrelegek 97 
                            yre+egek
  Traes_2BL_3237AA694.1 121 YREVEGEK 128
                            ******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.1E-5129138IPR009072Histone-fold
SuperFamilySSF471133.26E-3835141IPR009072Histone-fold
PfamPF008086.2E-2738102IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.8E-186684No hitNo description
PROSITE patternPS0068506985IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.8E-1885103No hitNo description
PRINTSPR006155.8E-18104122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MKSRKSYGQQ QSHLLSPVGS PSSDNGGGDS PAKEQDRFLP IANVSRIMKR SLPANAKISK  60
EAKETVQECV SEFISFVTGE ASDKCQREKR KTINGDDLLW AMTTLGFEVY VAPLKAYLNR  120
YREVEGEKAA VVGGSRHGDD DAHSSLSAAG DALAPQYPHG AGDRGVQDGD VGGHDAHVGL  180
MMGVNMGFSP GTGTTFYAAP GAAHGRRAYG GGEGARGIDF EGAFGGDRGK NGVGGEREFA  240
GHLHGAVQW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4633123292Transcription factor HapC (Eurofung)
4g92_B3e-4633123292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1246481e-121AB124648.1 Oryza sativa Indica Group Hd5 gene for Heading date 5, complete cds, cultivar:Kasalath.
GenBankAB1246491e-121AB124649.1 Oryza sativa Indica Group Hd5 mRNA for Heading date 5, complete cds, cultivar:Kasalath.
GenBankAY0621821e-121AY062182.1 Oryza sativa (indica cultivar-group) HAP3-like transcriptional-activator (HAP3b) mRNA, complete cds.
GenBankCP0126161e-121CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankCT8377941e-121CT837794.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA121O04, full insert sequence.
GenBankKR8153501e-121KR815350.1 Oryza sativa days to heading 8 (DTH8) gene, partial cds.
GenBankKR8153511e-121KR815351.1 Oryza sativa days to heading 8 (DTH8) gene, partial cds.
GenBankLC0167121e-121LC016712.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Qiu Zhao Zong.
GenBankLC0167131e-121LC016713.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Tupa 121-3.
GenBankLC0167141e-121LC016714.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Muha.
GenBankLC0167161e-121LC016716.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Deng Pao Zhai.
GenBankLC0167181e-121LC016718.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Naba.
GenBankLC0167191e-121LC016719.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bei Khe.
GenBankLC0167211e-121LC016721.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bleiyo.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445142.11e-92hypothetical protein SORBIDRAFT_07g004740
TrEMBLW5B8G40.0W5B8G4_WHEAT; Uncharacterized protein
STRINGMLOC_57782.11e-178(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.19e-63nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]